PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.YAF9X
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 435aa    MW: 48387.2 Da    PI: 8.0689
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.YAF9XgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-31258312155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r+rWt++LHe+Fve+v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Araip.YAF9X 258 KTRIRWTQDLHEKFVECVNRLGGAEKATPKAILRLMDSDGLTIFHVKSHLQKYRI 312
                  68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.499255315IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-28256313IPR009057Homeodomain-like
SuperFamilySSF466897.53E-17256312IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23258313IPR006447Myb domain, plants
PfamPF002493.6E-8262311IPR001005SANT/Myb domain
PfamPF143796.8E-20356402IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MNENKLDFHS EYGNRSSCQY FGIRQQPWNM GPCNNQPLGA TCVSVGVGRG RGGGGGEQEV  60
VLPYSAQAKP SSTIISRFES PASAFYATEI FMGFPQYDSH QVGNPSNLMP HQLSIKNINN  120
DMEFPLYQSS KESLFFDSSV NDQNSPNNFE LPNTLQAIKS QLNGDQCNGS PEKSNKIPCG  180
NFPASNFLPI EQHKLFNDDA APVTRSISIP KANQESTVAC GSFNSPVQQL SFSSPQEKLS  240
PTISAGNLVG NGPIASSKTR IRWTQDLHEK FVECVNRLGG AEKATPKAIL RLMDSDGLTI  300
FHVKSHLQKY RIAKYMPEST QGSYALPKKY FFPFSGKSEK RTSAENVHLD VKAGLQIKEA  360
LQLQLDVQRR LHEQLEIQRK LQLQIEEQGK QLKMMFDRQQ KSNNSERSSK DNNNDDNEVT  420
ILEGTGISHF PSKIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016177485.10.0PREDICTED: uncharacterized protein LOC107619706 isoform X1
TrEMBLA0A0B2RTW61e-162A0A0B2RTW6_GLYSO; Myb family transcription factor APL
TrEMBLI1JG491e-162I1JG49_SOYBN; Uncharacterized protein
TrEMBLA0A0B2PVD61e-162A0A0B2PVD6_GLYSO; Myb family transcription factor APL
TrEMBLK7LD831e-162K7LD83_SOYBN; Uncharacterized protein
STRINGGLYMA02G30800.11e-161(Glycine max)
STRINGGLYMA09G17404.11e-161(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.14e-70G2-like family protein